ZNF17 Antibody - N-terminal region (ARP36291_P050)

Data Sheet
 
Product Number ARP36291_P050
Product Page www.avivasysbio.com/znf17-antibody-n-terminal-region-arp36291-p050.html
Name ZNF17 Antibody - N-terminal region (ARP36291_P050)
Protein Size (# AA) 460 amino acids
Molecular Weight 53kDa
NCBI Gene Id 7565
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 17
Alias Symbols HPF3, KOX10
Peptide Sequence Synthetic peptide located within the following region: NLTCMQGGKDFTGDSDLQQQALHSGWKPHRDTHGVEAFQSGQNNYSCTQC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Huebner,K., et al., (1991) Am. J. Hum. Genet. 48 (4), 726-740
Description of Target ZNF17 is a new candidate transcription factor
Protein Interactions NDEL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF17 (ARP36291_P050) antibody
Blocking Peptide For anti-ZNF17 (ARP36291_P050) antibody is Catalog # AAP36291 (Previous Catalog # AAPP07650)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF17
Uniprot ID Q8N7M1
Protein Name Zinc finger protein 17
Protein Accession # NP_008890
Purification Affinity Purified
Nucleotide Accession # NM_006959
Tested Species Reactivity Human
Gene Symbol ZNF17
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Small Intestine
WB Suggested Anti-ZNF17 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com