Product Number |
ARP36291_P050 |
Product Page |
www.avivasysbio.com/znf17-antibody-n-terminal-region-arp36291-p050.html |
Name |
ZNF17 Antibody - N-terminal region (ARP36291_P050) |
Protein Size (# AA) |
460 amino acids |
Molecular Weight |
53kDa |
NCBI Gene Id |
7565 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 17 |
Alias Symbols |
HPF3, KOX10 |
Peptide Sequence |
Synthetic peptide located within the following region: NLTCMQGGKDFTGDSDLQQQALHSGWKPHRDTHGVEAFQSGQNNYSCTQC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Huebner,K., et al., (1991) Am. J. Hum. Genet. 48 (4), 726-740 |
Description of Target |
ZNF17 is a new candidate transcription factor |
Protein Interactions |
NDEL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF17 (ARP36291_P050) antibody |
Blocking Peptide |
For anti-ZNF17 (ARP36291_P050) antibody is Catalog # AAP36291 (Previous Catalog # AAPP07650) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF17 |
Uniprot ID |
Q8N7M1 |
Protein Name |
Zinc finger protein 17 |
Protein Accession # |
NP_008890 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006959 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF17 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Small Intestine
| WB Suggested Anti-ZNF17 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Human Small Intestine |
|
|