| Product Number |
ARP36283_P050 |
| Product Page |
www.avivasysbio.com/znf799-antibody-n-terminal-region-arp36283-p050.html |
| Name |
ZNF799 Antibody - N-terminal region (ARP36283_P050) |
| Protein Size (# AA) |
643 amino acids |
| Molecular Weight |
71kDa |
| NCBI Gene Id |
90576 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 799 |
| Alias Symbols |
HIT-40, ZNF842 |
| Peptide Sequence |
Synthetic peptide located within the following region: VIMGHSSLNCYIRVGAGHKPYEYHECGEKPDTHKQRGKAFSYHNSLQTHE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZNF799 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 18 C2H2-type zinc fingers and 1 KRAB domain. ZNF799 may be involved in transcriptional regulation. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF799 (ARP36283_P050) antibody |
| Blocking Peptide |
For anti-ZNF799 (ARP36283_P050) antibody is Catalog # AAP36283 (Previous Catalog # AAPP07642) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the n terminal region of human ZNF799 |
| Uniprot ID |
Q96GE5 |
| Protein Accession # |
XP_032678 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_032678 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF799 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HeLa
 | WB Suggested Anti-ZNF799 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate |
|
|
