| Product Number |
ARP36282_P050 |
| Product Page |
www.avivasysbio.com/znf835-antibody-middle-region-arp36282-p050.html |
| Name |
ZNF835 Antibody - middle region (ARP36282_P050) |
| Protein Size (# AA) |
592 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
90485 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 835 |
| Alias Symbols |
BC37295_3 |
| Peptide Sequence |
Synthetic peptide located within the following region: YTCQDCGALFSQSASLAEHRRIHTGEKPYACGQCAKAFTQVSHLTQHQRT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF835 (ARP36282_P050) antibody |
| Blocking Peptide |
For anti-ZNF835 (ARP36282_P050) antibody is Catalog # AAP36282 (Previous Catalog # AAPP07641) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF835. |
| Uniprot ID |
Q9Y2P0 |
| Protein Accession # |
XP_032059 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_032059 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF835 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 83%; Dog: 93%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 83%; Rabbit: 79%; Rat: 86%; Zebrafish: 85% |
| Image 1 | Human 721_B
 | WB Suggested Anti-ZNF835 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate |
|
|
