Product Number |
ARP36276_T100 |
Product Page |
www.avivasysbio.com/znf713-antibody-n-terminal-region-arp36276-t100.html |
Name |
ZNF713 Antibody - N-terminal region (ARP36276_T100) |
Protein Size (# AA) |
430 amino acids |
Molecular Weight |
50kDa |
NCBI Gene Id |
349075 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 713 |
Peptide Sequence |
Synthetic peptide located within the following region: ERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHKKITQERSL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
Description of Target |
ZNF713 is a new candidate transcription factor. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF713 (ARP36276_T100) antibody |
Blocking Peptide |
For anti-ZNF713 (ARP36276_T100) antibody is Catalog # AAP36276 (Previous Catalog # AAPP07635) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF713 |
Uniprot ID |
Q8N859 |
Protein Name |
Zinc finger protein 713 |
Protein Accession # |
NP_872439 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_182633 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF713 |
Predicted Species Reactivity |
Human, Mouse, Pig, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 90%; Pig: 77%; Yeast: 89% |
Image 1 | Human Spleen
| WB Suggested Anti-ZNF713 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: Human Spleen |
|
|