ZNF713 Antibody - N-terminal region (ARP36276_T100)

Data Sheet
 
Product Number ARP36276_T100
Product Page www.avivasysbio.com/znf713-antibody-n-terminal-region-arp36276-t100.html
Name ZNF713 Antibody - N-terminal region (ARP36276_T100)
Protein Size (# AA) 430 amino acids
Molecular Weight 50kDa
NCBI Gene Id 349075
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 713
Peptide Sequence Synthetic peptide located within the following region: ERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHKKITQERSL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target ZNF713 is a new candidate transcription factor.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF713 (ARP36276_T100) antibody
Blocking Peptide For anti-ZNF713 (ARP36276_T100) antibody is Catalog # AAP36276 (Previous Catalog # AAPP07635)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF713
Uniprot ID Q8N859
Protein Name Zinc finger protein 713
Protein Accession # NP_872439
Purification Protein A purified
Nucleotide Accession # NM_182633
Tested Species Reactivity Human
Gene Symbol ZNF713
Predicted Species Reactivity Human, Mouse, Pig, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 90%; Pig: 77%; Yeast: 89%
Image 1
Human Spleen
WB Suggested Anti-ZNF713 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Spleen
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com