| Product Number |
ARP36267_T100 |
| Product Page |
www.avivasysbio.com/flj31875-antibody-middle-region-arp36267-t100.html |
| Name |
FLJ31875 Antibody - middle region (ARP36267_T100) |
| Protein Size (# AA) |
439 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
197320 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 778 |
| Peptide Sequence |
Synthetic peptide located within the following region: AFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
Located on chromosome 16, the FLJ31875 gene encodes a hypothetical protein. |
| Protein Interactions |
KRTAP10-7; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF778 (ARP36267_T100) antibody |
| Blocking Peptide |
For anti-ZNF778 (ARP36267_T100) antibody is Catalog # AAP36267 (Previous Catalog # AAPP07626) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FLJ31875 |
| Uniprot ID |
Q96MU6 |
| Protein Name |
Zinc finger protein 778 |
| Protein Accession # |
NP_872337 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_182531 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF778 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-FLJ31875 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
