Product Number |
ARP36261_P050 |
Product Page |
www.avivasysbio.com/znf227-antibody-n-terminal-region-arp36261-p050.html |
Name |
ZNF227 Antibody - N-terminal region (ARP36261_P050) |
Protein Size (# AA) |
799 amino acids |
Molecular Weight |
92kDa |
NCBI Gene Id |
7770 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 227 |
Peptide Sequence |
Synthetic peptide located within the following region: QIWKQVASELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGDSSIYIENQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Shannon,M., et al., (2003) Genome Res. 13 (6A), 1097-1110 |
Description of Target |
ZNF227 is a new candidate transcription factor. |
Protein Interactions |
CEP70; UMPS; CBX5; RPS6KA6; GSK3B; CSNK1E; CDKN2A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF227 (ARP36261_P050) antibody |
Blocking Peptide |
For anti-ZNF227 (ARP36261_P050) antibody is Catalog # AAP36261 (Previous Catalog # AAPP07620) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF227 |
Uniprot ID |
Q86WZ6 |
Protein Name |
Zinc finger protein 227 |
Protein Accession # |
NP_872296 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_182490 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF227 |
Predicted Species Reactivity |
Human, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Human: 100% |
Image 1 | Human Small Intestine
| WB Suggested Anti-ZNF227 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Small Intestine |
|
|