ZFP42 Antibody - N-terminal region (ARP36244_P050)

• Product Number: ARP36244_P050
• Name: ZFP42 Antibody - N-terminal region (ARP36244_P050)
• Protein Size (# AA): 310 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 132625
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 42 homolog (mouse)
• Alias Symbols: REX1, REX-1, ZNF754, zfp-42
• Peptide Sequence: Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Moriscot,C., (2005) Stem Cells 23 (4), 594-603
• Description of Target: ZFP42 is a transcription factors and a specific marker of undifferentiated embryonic stem (ES) cells.
• Protein Interactions: RYBP; YAF2; EED; UBC; RNF2; RING1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-ZFP42 (ARP36244_P050) antibody is Catalog # AAP36244 (Previous Catalog # AAPP07603)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP42
• Uniprot ID: Q96MM3
• Protein Name: Zinc finger protein 42 homolog
• Protein Accession #: NP_777560
• Purification: Affinity Purified
• Nucleotide Accession #: NM_174900
• Tested Species Reactivity: Human
• Gene Symbol: ZFP42
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.