ZNF683 Antibody - N-terminal region (ARP36236_T100)

Data Sheet
 
Product Number ARP36236_T100
Product Page www.avivasysbio.com/znf683-antibody-n-terminal-region-arp36236-t100.html
Name ZNF683 Antibody - N-terminal region (ARP36236_T100)
Protein Size (# AA) 509 amino acids
Molecular Weight 55kDa
NCBI Gene Id 257101
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 683
Alias Symbols Hobit
Peptide Sequence Synthetic peptide located within the following region: PAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target This gene, ZNF683, which is located on chromosome 1, is predicted to encode a zinc finger protein, currently with unknown fucntion.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF683 (ARP36236_T100) antibody
Blocking Peptide For anti-ZNF683 (ARP36236_T100) antibody is Catalog # AAP36236 (Previous Catalog # AAPP07591)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF683
Uniprot ID Q8IZ20
Protein Name Zinc finger protein 683
Protein Accession # NP_775845
Purification Protein A purified
Nucleotide Accession # NM_173574
Tested Species Reactivity Human
Gene Symbol ZNF683
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNF683 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 2
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com