Product Number |
ARP36236_T100 |
Product Page |
www.avivasysbio.com/znf683-antibody-n-terminal-region-arp36236-t100.html |
Name |
ZNF683 Antibody - N-terminal region (ARP36236_T100) |
Protein Size (# AA) |
509 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
257101 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 683 |
Alias Symbols |
Hobit |
Peptide Sequence |
Synthetic peptide located within the following region: PAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
Description of Target |
This gene, ZNF683, which is located on chromosome 1, is predicted to encode a zinc finger protein, currently with unknown fucntion. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF683 (ARP36236_T100) antibody |
Blocking Peptide |
For anti-ZNF683 (ARP36236_T100) antibody is Catalog # AAP36236 (Previous Catalog # AAPP07591) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF683 |
Uniprot ID |
Q8IZ20 |
Protein Name |
Zinc finger protein 683 |
Protein Accession # |
NP_775845 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_173574 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF683 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF683 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
| Image 2 | Human Intestine
| Human Intestine |
|
|