ESX1 Antibody - N-terminal region (ARP36220_T100)

• Product Number: ARP36220_T100
• Name: ESX1 Antibody - N-terminal region (ARP36220_T100)
• Protein Size (# AA): 406 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 80712
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: ESX homeobox 1
• Alias Symbols: ESX1L, ESXR1
• Peptide Sequence: Synthetic peptide located within the following region: SLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDREGGGGHEPEQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Figueiredo,A.L., et al., (2004) J. Cell. Mol. Med. 8 (4), 545-550
• Description of Target: ESX1 is a homeobox gene related to the mouse Esx1 homeobox gene. ESX1 is expressed during all stages of placental development and is localized to sparse areas of trophoblast in terminal villi in association with cytotrophoblastic cells. Proteolytic processing of ESX1 plays a role in concerted regulation of the cell cycle and transcription in human cells.
• Protein Interactions: Dlg4; EXOC2; TRAP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ESX1 (ARP36220_T100) antibody is Catalog # AAP36220 (Previous Catalog # AAPP07575)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ESX1
• Uniprot ID: Q8N693
• Protein Name: Homeobox protein ESX1
• Protein Accession #: NP_703149
• Purification: Protein A purified
• Nucleotide Accession #: NM_153448
• Tested Species Reactivity: Human
• Gene Symbol: ESX1
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-ESX1 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate