GIOT-1 Antibody - N-terminal region (ARP36215_T100)

• Product Number: ARP36215_T100
• Name: GIOT-1 Antibody - N-terminal region (ARP36215_T100)
• Protein Size (# AA): 436 amino acids
• Molecular Weight: 48kDa
• NCBI Gene Id: 92283
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 461
• Alias Symbols: GIOT1, HZF28, GIOT-1
• Peptide Sequence: Synthetic peptide located within the following region: QHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mizutani,T., et al., (2001) Mol Endocrinol. 15 (10), 1693-705
• Description of Target: Gonadotropins are essential for ovarian follicular development and differentiation. Gene expression of GIOT1 is restricted to the pituitary, adrenal, testis, and ovary. The kruppel-associated box-A domain of GIOT1 is responsible for transcriptional repressor activity.
• Protein Interactions: KRTAP10-3; SF1; HDAC2; TOX2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF461 (ARP36215_T100) antibody is Catalog # AAP36215 (Previous Catalog # AAPP07570)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GIOT-1
• Uniprot ID: Q8TAF7-2
• Protein Name: Zinc finger protein 461
• Protein Accession #: AAH28631
• Purification: Protein A purified
• Nucleotide Accession #: NM_153257
• Tested Species Reactivity: Human
• Gene Symbol: ZNF461
• Predicted Species Reactivity: Human, Dog, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Horse: 85%; Human: 100%
• Image 1: Human Intestine
  
  Human Intestine
• Image 2: Human Thymus
  
  WB Suggested Anti-GIOT-1 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Thymus