Product Number |
ARP36204_P050 |
Product Page |
www.avivasysbio.com/znf555-antibody-n-terminal-region-arp36204-p050.html |
Name |
ZNF555 Antibody - N-terminal region (ARP36204_P050) |
Protein Size (# AA) |
628 amino acids |
Molecular Weight |
73kDa |
NCBI Gene Id |
148254 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 555 |
Alias Symbols |
MGC26707 |
Peptide Sequence |
Synthetic peptide located within the following region: PHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPYQCQEC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Dreier,B., Unpublished (2002) |
Description of Target |
ZNF555 contains 15 C2H2-type zinc fingers and 1 KRAB domain. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
Protein Interactions |
KRTAP10-7; CEP70; CCNDBP1; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF555 (ARP36204_P050) antibody |
Blocking Peptide |
For anti-ZNF555 (ARP36204_P050) antibody is Catalog # AAP36204 (Previous Catalog # AAPP07559) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF555 |
Uniprot ID |
Q8NEP9 |
Protein Name |
Zinc finger protein 555 |
Protein Accession # |
NP_690004 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152791 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF555 |
Predicted Species Reactivity |
Human, Dog |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 77%; Human: 100% |
Image 1 | Human 293T
| WB Suggested Anti-ZNF555 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 293T cell lysate |
| Image 2 | Human Pancreas
| Human Pancreas |
|
|