ZNF555 Antibody - N-terminal region (ARP36204_P050)

Data Sheet
 
Product Number ARP36204_P050
Product Page www.avivasysbio.com/znf555-antibody-n-terminal-region-arp36204-p050.html
Name ZNF555 Antibody - N-terminal region (ARP36204_P050)
Protein Size (# AA) 628 amino acids
Molecular Weight 73kDa
NCBI Gene Id 148254
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 555
Alias Symbols MGC26707
Peptide Sequence Synthetic peptide located within the following region: PHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPYQCQEC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Dreier,B., Unpublished (2002)
Description of Target ZNF555 contains 15 C2H2-type zinc fingers and 1 KRAB domain. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Protein Interactions KRTAP10-7; CEP70; CCNDBP1; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF555 (ARP36204_P050) antibody
Blocking Peptide For anti-ZNF555 (ARP36204_P050) antibody is Catalog # AAP36204 (Previous Catalog # AAPP07559)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF555
Uniprot ID Q8NEP9
Protein Name Zinc finger protein 555
Protein Accession # NP_690004
Purification Affinity Purified
Nucleotide Accession # NM_152791
Tested Species Reactivity Human
Gene Symbol ZNF555
Predicted Species Reactivity Human, Dog
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 77%; Human: 100%
Image 1
Human 293T
WB Suggested Anti-ZNF555 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Image 2
Human Pancreas
Human Pancreas
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com