| Product Number |
ARP36183_P050 |
| Product Page |
www.avivasysbio.com/znf785-antibody-c-terminal-region-arp36183-p050.html |
| Name |
ZNF785 Antibody - C-terminal region (ARP36183_P050) |
| Protein Size (# AA) |
405 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
146540 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 785 |
| Alias Symbols |
ZNF688 |
| Peptide Sequence |
Synthetic peptide located within the following region: RKTALEAHRWIHRSCSERRAWQQAVVGRSEPIPVLGGKDPPVHFRHFPDI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Loftus,B.J., (1999) Genomics 60 (3), 295-308 |
| Description of Target |
The function of ZNF785 remains unknown. |
| Protein Interactions |
KRTAP10-5; KRTAP10-1; HOOK1; MTUS2; MID2; EHMT2; PRR7; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF785 (ARP36183_P050) antibody |
| Blocking Peptide |
For anti-ZNF785 (ARP36183_P050) antibody is Catalog # AAP36183 (Previous Catalog # AAPP07538) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF785 |
| Uniprot ID |
Q8WV14-2 |
| Protein Accession # |
NP_689671 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152458 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF785 |
| Predicted Species Reactivity |
Human, Dog |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Human: 100% |
| Image 1 | Human Intestine
 | Human Intestine |
| | Image 2 | Transfected 293T
 | WB Suggested Anti-ZNF785 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T |
|
|
