Product Number |
ARP36182_P050 |
Product Page |
www.avivasysbio.com/znf785-antibody-n-terminal-region-arp36182-p050.html |
Name |
ZNF785 Antibody - N-terminal region (ARP36182_P050) |
Protein Size (# AA) |
405 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
146540 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 785 |
Alias Symbols |
ZNF688 |
Peptide Sequence |
Synthetic peptide located within the following region: EAQDPDGESSAAFSRGQGQEAGSRDGNEEKERLKKCPKQKEVAHEVAVKE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Loftus,B.J., (1999) Genomics 60 (3), 295-308 |
Description of Target |
The function of ZNF785 remains unknown. |
Protein Interactions |
KRTAP10-5; KRTAP10-1; HOOK1; MTUS2; MID2; EHMT2; PRR7; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF785 (ARP36182_P050) antibody |
Blocking Peptide |
For anti-ZNF785 (ARP36182_P050) antibody is Catalog # AAP36182 (Previous Catalog # AAPP07537) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF785 |
Uniprot ID |
Q8WV14-2 |
Protein Accession # |
NP_689671 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152458 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF785 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Transfected 293T
| WB Suggested Anti-ZNF785 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Transfected 293T |
|
|