Product Number |
ARP36172_P050 |
Product Page |
www.avivasysbio.com/znf491-antibody-n-terminal-region-arp36172-p050.html |
Name |
ZNF491 Antibody - N-terminal region (ARP36172_P050) |
Protein Size (# AA) |
437 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
126069 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 491 |
Alias Symbols |
FLJ34791, MGC126639, MGC126641 |
Peptide Sequence |
Synthetic peptide located within the following region: SFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTRE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
The function of ZNF491has not yet been determined. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF491 (ARP36172_P050) antibody |
Blocking Peptide |
For anti-ZNF491 (ARP36172_P050) antibody is Catalog # AAP36172 (Previous Catalog # AAPP07527) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF491 |
Uniprot ID |
Q8N8L2 |
Protein Name |
Zinc finger protein 491 |
Protein Accession # |
NP_689569 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152356 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF491 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF491 Antibody Titration: 0.125ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|
|