| Product Number |
ARP36171_P050 |
| Product Page |
www.avivasysbio.com/znf441-antibody-n-terminal-region-arp36171-p050.html |
| Name |
ZNF441 Antibody - N-terminal region (ARP36171_P050) |
| Protein Size (# AA) |
626 amino acids |
| Molecular Weight |
72kDa |
| NCBI Gene Id |
126068 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 441 |
| Alias Symbols |
FLJ38637 |
| Peptide Sequence |
Synthetic peptide located within the following region: MVERACEIKDNSQCGGPFTQTQDSIVNEKIPGVDPWESSECTDVLMGRSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Isogai,T. Unpublished (2002) |
| Description of Target |
ZNF441 contains 19 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF441 (ARP36171_P050) antibody |
| Blocking Peptide |
For anti-ZNF441 (ARP36171_P050) antibody is Catalog # AAP36171 (Previous Catalog # AAPS06903) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF441 |
| Uniprot ID |
Q8N8Z8 |
| Protein Name |
Zinc finger protein 441 |
| Protein Accession # |
NP_689568 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152355 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF441 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF441 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
