| Product Number |
ARP36165_T100 |
| Product Page |
www.avivasysbio.com/znf276-antibody-middle-region-arp36165-t100.html |
| Name |
ZNF276 Antibody - middle region (ARP36165_T100) |
| Protein Size (# AA) |
539 amino acids |
| Molecular Weight |
60kDa |
| NCBI Gene Id |
92822 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 276 |
| Alias Symbols |
ZADT, CENPZ, CENP-Z, ZFP276, ZNF477 |
| Peptide Sequence |
Synthetic peptide located within the following region: SFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wong,J.C., et al., (2003) J. Hum. Genet. 48 (12), 668-671 |
| Description of Target |
The function of Anti-ZNF276 has not yet been determined. |
| Protein Interactions |
ZBTB8A; GCC1; ATXN1; ZBTB8B; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF276 (ARP36165_T100) antibody |
| Blocking Peptide |
For anti-ZNF276 (ARP36165_T100) antibody is Catalog # AAP36165 (Previous Catalog # AAPP08940) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF276 |
| Uniprot ID |
Q8N554 |
| Protein Name |
Zinc finger protein 276 |
| Protein Accession # |
NP_689500 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_152287 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF276 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF276 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
