| Product Number |
ARP36135_T100 |
| Product Page |
www.avivasysbio.com/sp140l-antibody-middle-region-arp36135-t100.html |
| Name |
SP140L Antibody - middle region (ARP36135_T100) |
| Protein Size (# AA) |
351 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
93349 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
SP140 nuclear body protein-like |
| Peptide Sequence |
Synthetic peptide located within the following region: TVDFQAPLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
Located on chromosome 2, the LOC93349 gene encodes a hypothetical protein with unknown function. |
| Protein Interactions |
UBC; APP; NEDD4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SP140L (ARP36135_T100) antibody |
| Blocking Peptide |
For anti-SP140L (ARP36135_T100) antibody is Catalog # AAP36135 (Previous Catalog # AAPP08253) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LOC93349 |
| Uniprot ID |
Q9H930 |
| Protein Name |
Nuclear body protein SP140-like protein |
| Protein Accession # |
NP_612411 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_138402 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SP140L |
| Predicted Species Reactivity |
Human, Rat, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 80%; Human: 100%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SP140L Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
