ZNF551 Antibody - N-terminal region (ARP36133_T100)

• Product Number: ARP36133_T100
• Name: ZNF551 Antibody - N-terminal region (ARP36133_T100)
• Protein Size (# AA): 362 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 90233
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 551
• Peptide Sequence: Synthetic peptide located within the following region: FVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Thiesen,H.J., et al., (1990) New Biol. (4), 363-74
• Description of Target: Located on chromosome 19, ZNF551 encodes a protein that is part of the zinc finger protein family.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF551 (ARP36133_T100) antibody is Catalog # AAP36133 (Previous Catalog # AAPP08251)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF551
• Uniprot ID: Q7Z340-3
• Protein Name: Zinc finger protein 551
• Sample Type Confirmation:

  ZNF551 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: BAC03625
• Purification: Protein A purified
• Nucleotide Accession #: NM_138347
• Tested Species Reactivity: Human
• Gene Symbol: ZNF551
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Liver
  
  Human Liver
• Image 2: Human Jurkat
  
  WB Suggested Anti-ZNF551 Antibody Titration: 0.6ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysateZNF551 is supported by BioGPS gene expression data to be expressed in Jurkat