| Product Number |
ARP36127_P050 |
| Product Page |
www.avivasysbio.com/ctcfl-antibody-n-terminal-region-arp36127-p050.html |
| Name |
CTCFL Antibody - N-terminal region (ARP36127_P050) |
| Protein Size (# AA) |
663 amino acids |
| Molecular Weight |
76kDa |
| NCBI Gene Id |
140690 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CCCTC-binding factor (zinc finger protein)-like |
| Alias Symbols |
CT27, BORIS, CTCF-T, HMGB1L1, dJ579F20.2 |
| Peptide Sequence |
Synthetic peptide located within the following region: RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hong,J.A., et al., (2005) Cancer Res. 65 (17), 7763-7774 |
| Description of Target |
CTCFL is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes. CTCFL is normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. |
| Protein Interactions |
SP1; BAG6; HIST2H2AC; HIST1H1A; PRMT7; HIST1H3A; BRCA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CTCFL (ARP36127_P050) antibody |
| Blocking Peptide |
For anti-CTCFL (ARP36127_P050) antibody is Catalog # AAP36127 (Previous Catalog # AAPP08248) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CTCFL |
| Uniprot ID |
Q8NI51 |
| Protein Name |
Transcriptional repressor CTCFL |
| Sample Type Confirmation |
CTCFL is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_542185 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_080618 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CTCFL |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CTCFL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateCTCFL is supported by BioGPS gene expression data to be expressed in Jurkat |
|
