CCDC16 Antibody - middle region (ARP36112_T100)

Data Sheet
 
Product Number ARP36112_T100
Product Page www.avivasysbio.com/ccdc16-antibody-middle-region-arp36112-t100.html
Name CCDC16 Antibody - middle region (ARP36112_T100)
Protein Size (# AA) 372 amino acids
Molecular Weight 42kDa
NCBI Gene Id 91603
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 830
Alias Symbols OMCG1, CCDC16
Peptide Sequence Synthetic peptide located within the following region: ENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target Located on chromosome 17, this gene encodes for a coiled-coil domain containing 16 protein with unknown function.
Protein Interactions UBC; FRA10AC1; PPIL2; SNW1; SF3B2; PRPF8; AQR; THOC5; RAB4A; PCBP1; ILF3; IK; WIPF2; THOC1; YY1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF830 (ARP36112_T100) antibody
Blocking Peptide For anti-ZNF830 (ARP36112_T100) antibody is Catalog # AAP36112 (Previous Catalog # AAPP07440)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CCDC16
Uniprot ID Q96NB3
Protein Name Zinc finger protein 830
Protein Accession # NP_443089
Purification Protein A purified
Nucleotide Accession # NM_052857
Tested Species Reactivity Human
Gene Symbol ZNF830
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-CCDC16 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com