CREB3L1 Antibody - N-terminal region (ARP36109_T100)

Data Sheet
 
Product Number ARP36109_T100
Product Page www.avivasysbio.com/creb3l1-antibody-n-terminal-region-arp36109-t100.html
Name CREB3L1 Antibody - N-terminal region (ARP36109_T100)
Protein Size (# AA) 519 amino acids
Molecular Weight 57kDa
NCBI Gene Id 90993
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name CAMP responsive element binding protein 3-like 1
Description
Alias Symbols OI16, OASIS
Peptide Sequence Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Omori,Y., et al., (2002) Biochem. Biophys. Res. Commun. 293 (1), 470-477
Description of Target The CREB3L1 gene encodes a protein with a transmembrane domain that is a transcriptional activator of the CREB/ATF family.
Protein Interactions TMEM218; SLC30A8; MFSD5; SLC35B4; JAGN1; TMEM234; FXYD6; NRM; PGRMC1; FAM3C; TMEM147; PRKAB2; GPR25; RUNX1T1; C5; TSPO; Fbxw7; UBE2D3; UBA1; CREB3L1; CREB3L3; CREB3; DDIT3; CREM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-CREB3L1 (ARP36109_T100) antibody
Blocking Peptide For anti-CREB3L1 (ARP36109_T100) antibody is Catalog # AAP36109 (Previous Catalog # AAPP07437)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L1
Uniprot ID Q96CP0
Protein Name Cyclic AMP-responsive element-binding protein 3-like protein 1
Publications

CREB3L1-mediated functional and structural adaptation of the secretory pathway in hormone-stimulated thyroid cells. J Cell Sci. 130, 4155-4167 (2017). 29093023

Protein Accession # NP_443086
Purification Protein A purified
Nucleotide Accession # NM_052854
Tested Species Reactivity Human
Gene Symbol CREB3L1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Fetal Lung
Host: Rabbit
Target Name: CREB3L1
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 2

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. The peptide is present in both a 57 kDa and a 48 kDa isoform.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com