ZNF670 Antibody - N-terminal region (ARP36101_T100)

Data Sheet
 
Product Number ARP36101_T100
Product Page www.avivasysbio.com/znf670-antibody-n-terminal-region-arp36101-t100.html
Name ZNF670 Antibody - N-terminal region (ARP36101_T100)
Protein Size (# AA) 389 amino acids
Molecular Weight 45kDa
NCBI Gene Id 93474
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 670
Peptide Sequence Synthetic peptide located within the following region: EDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target This gene, ZNF670, which is located on chromosome 1, is predicted to encode a zinc finger protein, currently with unknown fucntion.
Protein Interactions KRTAP10-3; KRTAP10-5; KRTAP10-7; TRIM41; TSGA10; CCNDBP1; MTUS2; OPTN; SUV39H1; MDFI; CSNK2A2; UBC; KIAA1279;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF670 (ARP36101_T100) antibody
Blocking Peptide For anti-ZNF670 (ARP36101_T100) antibody is Catalog # AAP36101 (Previous Catalog # AAPP07429)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF670
Uniprot ID Q9BS34
Protein Name Zinc finger protein 670
Protein Accession # NP_149990
Purification Protein A purified
Nucleotide Accession # NM_033213
Tested Species Reactivity Human
Gene Symbol ZNF670
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNF670 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com