DMRTB1 Antibody - middle region (ARP36094_T100)

Data Sheet
 
Product Number ARP36094_T100
Product Page www.avivasysbio.com/dmrtb1-antibody-middle-region-arp36094-t100.html
Name DMRTB1 Antibody - middle region (ARP36094_T100)
Protein Size (# AA) 342 amino acids
Molecular Weight 36kDa
NCBI Gene Id 63948
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name DMRT-like family B with proline-rich C-terminal, 1
Peptide Sequence Synthetic peptide located within the following region: YPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ottolenghi,C., et al., (2002) Genomics 79 (3), 333-343
Description of Target Located on chromosome 1, this gene encodes for the DMRT-like family B with proline-rich C-terminal, 1 protein.
Protein Interactions CTBP2; CTBP1; NIF3L1; VASP; IL16; LENG8; RBFOX1; RBFOX2; SORBS3; NCKIPSD; PRMT2; EYA2; EWSR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DMRTB1 (ARP36094_T100) antibody
Blocking Peptide For anti-DMRTB1 (ARP36094_T100) antibody is Catalog # AAP36094 (Previous Catalog # AAPP07422)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DMRTB1
Uniprot ID Q96MA1
Protein Name Doublesex- and mab-3-related transcription factor B1
Protein Accession # NP_149056
Purification Protein A purified
Nucleotide Accession # NM_033067
Tested Species Reactivity Human
Gene Symbol DMRTB1
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-DMRTB1 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com