| Product Number |
ARP36086_P050 |
| Product Page |
www.avivasysbio.com/znf566-antibody-middle-region-arp36086-p050.html |
| Name |
ZNF566 Antibody - middle region (ARP36086_P050) |
| Protein Size (# AA) |
418 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
84924 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 566 |
| Alias Symbols |
FLJ14779, MGC12515 |
| Peptide Sequence |
Synthetic peptide located within the following region: VFTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEII |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
| Description of Target |
ZNF566 may be involved in transcriptional regulation. |
| Protein Interactions |
KIF2C; CBX5; UBD; SMARCAD1; UBC; Trim28; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF566 (ARP36086_P050) antibody |
| Blocking Peptide |
For anti-ZNF566 (ARP36086_P050) antibody is Catalog # AAP36086 (Previous Catalog # AAPP07396) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF566 |
| Uniprot ID |
Q969W8 |
| Protein Name |
Zinc finger protein 566 |
| Protein Accession # |
NP_116227 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_032838 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF566 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 87%; Dog: 80%; Horse: 87%; Human: 100%; Pig: 93%; Rat: 80% |
| Image 1 | Human kidney
 | WB Suggested Anti-ZNF566 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney |
|
|
