| Product Number |
ARP36080_T100 |
| Product Page |
www.avivasysbio.com/raxl1-antibody-n-terminal-region-arp36080-t100.html |
| Name |
RAXL1 Antibody - N-terminal region (ARP36080_T100) |
| Protein Size (# AA) |
184 amino acids |
| Molecular Weight |
20kDa |
| NCBI Gene Id |
84839 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Retina and anterior neural fold homeobox 2 |
| Alias Symbols |
QRX, ARMD6, RAXL1, CORD11 |
| Peptide Sequence |
Synthetic peptide located within the following region: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
RAXL1 is a hypothetical protein |
| Protein Interactions |
CRX; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RAX2 (ARP36080_T100) antibody |
| Blocking Peptide |
For anti-RAX2 (ARP36080_T100) antibody is Catalog # AAP36080 (Previous Catalog # AAPP07390) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RAXL1 |
| Uniprot ID |
Q96IS3 |
| Protein Name |
Retina and anterior neural fold homeobox protein 2 |
| Protein Accession # |
NP_116142 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_032753 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RAX2 |
| Predicted Species Reactivity |
Human, Cow, Dog, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 85%; Human: 100%; Pig: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-RAXL1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
