| Product Number |
ARP36069_T100 |
| Product Page |
www.avivasysbio.com/znf559-antibody-n-terminal-region-arp36069-t100.html |
| Name |
ZNF559 Antibody - N-terminal region (ARP36069_T100) |
| Protein Size (# AA) |
538 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
84527 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 559 |
| Alias Symbols |
NBLA00121 |
| Peptide Sequence |
Synthetic peptide located within the following region: LPSSSHLRECVRIYGGERPYTHKEYVETFSHSTALFVHMQTQDGEKFYEC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
ZNF559 is a new candidate transcription factor. |
| Protein Interactions |
KRTAP4-2; MDFI; KRTAP10-3; KRTAP10-5; KRTAP10-1; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF559 (ARP36069_T100) antibody |
| Blocking Peptide |
For anti-ZNF559 (ARP36069_T100) antibody is Catalog # AAP36069 (Previous Catalog # AAPP07379) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF559 |
| Uniprot ID |
Q9BR84 |
| Protein Name |
Zinc finger protein 559 |
| Protein Accession # |
NP_115886 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_032497 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF559 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF559 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
