ZNF323 Antibody - middle region (ARP36063_T100)

Data Sheet
 
Product Number ARP36063_T100
Product Page www.avivasysbio.com/znf323-antibody-middle-region-arp36063-t100.html
Name ZNF323 Antibody - middle region (ARP36063_T100)
Protein Size (# AA) 406 amino acids
Molecular Weight 47kDa
NCBI Gene Id 64288
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 323
Alias Symbols ZNF323, ZNF310P, ZNF20-Lp
Peptide Sequence Synthetic peptide located within the following region: QEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pi,H., et al., (2002) Biochem. Biophys. Res. Commun. 296 (1), 206-213
Description of Target The ZNF323 gene encodes a protein that plays a role in early human embryonic development.
Protein Interactions DDIT3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZSCAN31 (ARP36063_T100) antibody
Blocking Peptide For anti-ZSCAN31 (ARP36063_T100) antibody is Catalog # AAP36063 (Previous Catalog # AAPP07373)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF323
Uniprot ID Q96LW9
Protein Name Zinc finger protein 323
Protein Accession # NP_665916
Purification Protein A purified
Nucleotide Accession # NM_145909
Tested Species Reactivity Human
Gene Symbol ZSCAN31
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZNF323 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com