Product Number |
ARP36063_T100 |
Product Page |
www.avivasysbio.com/znf323-antibody-middle-region-arp36063-t100.html |
Name |
ZNF323 Antibody - middle region (ARP36063_T100) |
Protein Size (# AA) |
406 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
64288 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 323 |
Alias Symbols |
ZNF323, ZNF310P, ZNF20-Lp |
Peptide Sequence |
Synthetic peptide located within the following region: QEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Pi,H., et al., (2002) Biochem. Biophys. Res. Commun. 296 (1), 206-213 |
Description of Target |
The ZNF323 gene encodes a protein that plays a role in early human embryonic development. |
Protein Interactions |
DDIT3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZSCAN31 (ARP36063_T100) antibody |
Blocking Peptide |
For anti-ZSCAN31 (ARP36063_T100) antibody is Catalog # AAP36063 (Previous Catalog # AAPP07373) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF323 |
Uniprot ID |
Q96LW9 |
Protein Name |
Zinc finger protein 323 |
Protein Accession # |
NP_665916 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_145909 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZSCAN31 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF323 Antibody Titration: 2.5ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|
|