| Product Number |
ARP36056_T100 |
| Product Page |
www.avivasysbio.com/hoxa3-antibody-c-terminal-region-arp36056-t100.html |
| Name |
HOXA3 Antibody - C-terminal region (ARP36056_T100) |
| Protein Size (# AA) |
443 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
3200 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Homeobox A3 |
| Alias Symbols |
HOX1, HOX1E |
| Peptide Sequence |
Synthetic peptide located within the following region: MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPAC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Scherer,S.W., et al., (2003) Science 300 (5620), 767-772 |
| Description of Target |
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. The HOXA3 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. |
| Protein Interactions |
SEC23B; ARPC3; TINF2; POT1; TERF1; ALX4; PWP1; SOX10; E2F4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXA3 (ARP36056_T100) antibody |
| Blocking Peptide |
For anti-HOXA3 (ARP36056_T100) antibody is Catalog # AAP36056 (Previous Catalog # AAPP07366) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human HOXA3 |
| Uniprot ID |
O43365 |
| Protein Name |
Homeobox protein Hox-A3 |
| Protein Accession # |
NP_109377 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_030661 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
HOXA3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-HOXA3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
| Image 2 | Mouse Pancreas
 | Host: Mouse
Target Name: HOXA3
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml |
|
| Image 3 | Human Fetal Brain
 | Host: Rabbit
Target Name: HOXA3
Sample Type: Human Fetal Brain
Antibody Dilution: 1.0ug/ml |
|
