ZNF435 Antibody - middle region (ARP36053_T100)

Data Sheet
 
Product Number ARP36053_T100
Product Page www.avivasysbio.com/znf435-antibody-middle-region-arp36053-t100.html
Name ZNF435 Antibody - middle region (ARP36053_T100)
Protein Size (# AA) 348 amino acids
Molecular Weight 41kDa
NCBI Gene Id 80345
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger and SCAN domain containing 16
Alias Symbols ZNF392, ZNF435, dJ265C24.3
Peptide Sequence Synthetic peptide located within the following region: TKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sugano,S., Unpublished (2000)
Description of Target ZNF435 contains 1 SCAN box domain and 4 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc finger protein family and may be involved in transcriptional regulation.
Protein Interactions ZNF446; APP; SLC25A38;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZSCAN16 (ARP36053_T100) antibody
Blocking Peptide For anti-ZSCAN16 (ARP36053_T100) antibody is Catalog # AAP36053 (Previous Catalog # AAPP07363)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF435
Uniprot ID Q9H4T2
Protein Name Zinc finger and SCAN domain-containing protein 16
Protein Accession # NP_079507
Purification Protein A purified
Nucleotide Accession # NM_025231
Tested Species Reactivity Human
Gene Symbol ZSCAN16
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Transfected 293T
WB Suggested Anti-ZNF435 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com