Product Number |
ARP36053_T100 |
Product Page |
www.avivasysbio.com/znf435-antibody-middle-region-arp36053-t100.html |
Name |
ZNF435 Antibody - middle region (ARP36053_T100) |
Protein Size (# AA) |
348 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
80345 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger and SCAN domain containing 16 |
Alias Symbols |
ZNF392, ZNF435, dJ265C24.3 |
Peptide Sequence |
Synthetic peptide located within the following region: TKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sugano,S., Unpublished (2000) |
Description of Target |
ZNF435 contains 1 SCAN box domain and 4 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc finger protein family and may be involved in transcriptional regulation. |
Protein Interactions |
ZNF446; APP; SLC25A38; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZSCAN16 (ARP36053_T100) antibody |
Blocking Peptide |
For anti-ZSCAN16 (ARP36053_T100) antibody is Catalog # AAP36053 (Previous Catalog # AAPP07363) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF435 |
Uniprot ID |
Q9H4T2 |
Protein Name |
Zinc finger and SCAN domain-containing protein 16 |
Protein Accession # |
NP_079507 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_025231 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZSCAN16 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Transfected 293T
| WB Suggested Anti-ZNF435 Antibody Titration: 2.5ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T |
|
|