| Product Number |
ARP36050_T100 |
| Product Page |
www.avivasysbio.com/znf556-antibody-c-terminal-region-arp36050-t100.html |
| Name |
ZNF556 Antibody - C-terminal region (ARP36050_T100) |
| Protein Size (# AA) |
456 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
80032 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 556 |
| Peptide Sequence |
Synthetic peptide located within the following region: KAFGWPSSLHKHARTHAKKKPVSGGSVGKSSARPRPSTDVKSQTREKVYK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
ZNF556 is a new candidate transcription factor. |
| Protein Interactions |
ELAVL1; ZBTB3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF556 (ARP36050_T100) antibody |
| Blocking Peptide |
For anti-ZNF556 (ARP36050_T100) antibody is Catalog # AAP36050 (Previous Catalog # AAPP07360) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF556 |
| Uniprot ID |
Q9HAH1 |
| Protein Name |
Zinc finger protein 556 |
| Sample Type Confirmation |
ZNF556 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_079243 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_024967 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF556 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF556 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateZNF556 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
|
