ZNF665 Antibody - N-terminal region (ARP36043_T100)

• Product Number: ARP36043_T100
• Name: ZNF665 Antibody - N-terminal region (ARP36043_T100)
• Protein Size (# AA): 450 amino acids
• Molecular Weight: 78kDa
• NCBI Gene Id: 79788
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 665
• Alias Symbols: ZFP160L
• Peptide Sequence: Synthetic peptide located within the following region: CGKAFTVRSNLTIHQVIHTGEKPYKCNECGKVFSQPSNLAGHQRIHTGEK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Poustka,A., et al., (2003), unpublished
• Description of Target: ZNF665 is a new candidate transcription factor. Western blots using two different antibodies (ARP36042-T200 and ARP36043_T200) against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF665 (ARP36043_T100) antibody is Catalog # AAP36043 (Previous Catalog # AAPP07353)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665
• Uniprot ID: Q9H7R5
• Purification: Protein A purified
• Nucleotide Accession #: NM_024733
• Tested Species Reactivity: Human
• Gene Symbol: ZNF665
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 85%; Rat: 86%
• Image 1: Human HepG2
  
  WB Suggested Anti-ZNF665 Antibody Titration: 5.0ug/ml
  ELISA Titer: 1:12500
  Positive Control: HepG2 cell lysate