ZNF665 Antibody - N-terminal region (ARP36042_T100)

Data Sheet
 
Product Number ARP36042_T100
Product Page www.avivasysbio.com/znf665-antibody-n-terminal-region-arp36042-t100.html
Name ZNF665 Antibody - N-terminal region (ARP36042_T100)
Protein Size (# AA) 450 amino acids
Molecular Weight 78kDa
NCBI Gene Id 79788
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 665
Alias Symbols ZFP160L
Peptide Sequence Synthetic peptide located within the following region: LGVSFQSHLPELQQFQREGKIYEYNQVEKSPNNRGKHYKCDECGKVFSQN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Poustka,A., et al., (2003), unpublished
Description of Target ZNF665 is a new candidate transcription factor. Western blots using two different antibodies (ARP36042-T200 and ARP36043_T200) against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF665 (ARP36042_T100) antibody
Blocking Peptide For anti-ZNF665 (ARP36042_T100) antibody is Catalog # AAP36042 (Previous Catalog # AAPP07352)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665
Uniprot ID Q9H7R5
Purification Protein A purified
Nucleotide Accession # NM_024733
Tested Species Reactivity Human
Gene Symbol ZNF665
Predicted Species Reactivity Human, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 85%; Horse: 91%; Human: 100%; Pig: 82%; Rabbit: 90%
Image 1
Human HepG2
WB Suggested Anti-ZNF665 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com