Product Number |
ARP36024_T100 |
Product Page |
www.avivasysbio.com/flj12644-antibody-c-terminal-region-arp36024-t100.html |
Name |
FLJ12644 Antibody - C-terminal region (ARP36024_T100) |
Protein Size (# AA) |
505 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
65251 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 649 |
Peptide Sequence |
Synthetic peptide located within the following region: EKAYFYMSCLVKHKRIHSREKRGDSVKVENPSTASHSLSPSEHVQGKSPV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
The FLJ12644 gene encodes a protein may act as a transcriptional repressor in mitogen-activated protein kinase signaling pathway to mediate cellular functions. |
Protein Interactions |
SUV39H1; CBX5; SMARCAD1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF649 (ARP36024_T100) antibody |
Blocking Peptide |
For anti-ZNF649 (ARP36024_T100) antibody is Catalog # AAP36024 (Previous Catalog # AAPP07334) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ12644 |
Uniprot ID |
Q9H9N2 |
Protein Name |
Zinc finger protein 649 |
Protein Accession # |
NP_075562 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_023074 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF649 |
Predicted Species Reactivity |
Human, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 77%; Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-FLJ12644 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
|
|