| Product Number |
ARP36010_T100 |
| Product Page |
www.avivasysbio.com/znf70-antibody-n-terminal-region-arp36010-t100.html |
| Name |
ZNF70 Antibody - N-terminal region (ARP36010_T100) |
| Protein Size (# AA) |
446 amino acids |
| Molecular Weight |
51kDa |
| NCBI Gene Id |
7621 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 70 |
| Alias Symbols |
Cos17 |
| Peptide Sequence |
Synthetic peptide located within the following region: ETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Aubry,M., et al., (1992) Genomics 13 (3), 641-648 |
| Description of Target |
The function of the ZNF70 gene has not yet been determined |
| Protein Interactions |
ZFP64; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF70 (ARP36010_T100) antibody |
| Blocking Peptide |
For anti-ZNF70 (ARP36010_T100) antibody is Catalog # AAP36010 (Previous Catalog # AAPP07320) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF70 |
| Uniprot ID |
Q9UC06 |
| Protein Name |
Zinc finger protein 70 |
| Protein Accession # |
NP_068735 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021916 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF70 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Intestine
 | Human Intestine |
| | Image 2 | Human Jurkat
 | WB Suggested Anti-ZNF70 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
