Product Number |
ARP36000_T100 |
Product Page |
www.avivasysbio.com/hes4-antibody-middle-region-arp36000-t100.html |
Name |
HES4 Antibody - middle region (ARP36000_T100) |
Protein Size (# AA) |
221 amino acids |
Molecular Weight |
24kDa |
NCBI Gene Id |
57801 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Hairy and enhancer of split 4 (Drosophila) |
Alias Symbols |
bHLHb42 |
Peptide Sequence |
Synthetic peptide located within the following region: GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Katoh,M. (2004) Int. J. Oncol. 25 (2), 529-534 |
Description of Target |
The function remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
Protein Interactions |
COPG2; LTN1; RGS3; UBD; PCBD2; PCBD1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HES4 (ARP36000_T100) antibody |
Blocking Peptide |
For anti-HES4 (ARP36000_T100) antibody is Catalog # AAP36000 (Previous Catalog # AAPP07310) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HES4 |
Uniprot ID |
Q9HCC6 |
Protein Name |
Transcription factor HES-4 |
Protein Accession # |
NP_066993 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_021170 |
Tested Species Reactivity |
Human |
Gene Symbol |
HES4 |
Predicted Species Reactivity |
Human, Cow |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Human: 100% |
Image 1 | Transfected 293T
| WB Suggested Anti-HES4 Antibody Titration: 5.0ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T |
|
|