HES4 Antibody - middle region (ARP36000_T100)

Data Sheet
 
Product Number ARP36000_T100
Product Page www.avivasysbio.com/hes4-antibody-middle-region-arp36000-t100.html
Name HES4 Antibody - middle region (ARP36000_T100)
Protein Size (# AA) 221 amino acids
Molecular Weight 24kDa
NCBI Gene Id 57801
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Hairy and enhancer of split 4 (Drosophila)
Alias Symbols bHLHb42
Peptide Sequence Synthetic peptide located within the following region: GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Katoh,M. (2004) Int. J. Oncol. 25 (2), 529-534
Description of Target The function remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Protein Interactions COPG2; LTN1; RGS3; UBD; PCBD2; PCBD1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HES4 (ARP36000_T100) antibody
Blocking Peptide For anti-HES4 (ARP36000_T100) antibody is Catalog # AAP36000 (Previous Catalog # AAPP07310)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HES4
Uniprot ID Q9HCC6
Protein Name Transcription factor HES-4
Protein Accession # NP_066993
Purification Protein A purified
Nucleotide Accession # NM_021170
Tested Species Reactivity Human
Gene Symbol HES4
Predicted Species Reactivity Human, Cow
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 91%; Human: 100%
Image 1
Transfected 293T
WB Suggested Anti-HES4 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com