| Product Number |
ARP35997_T100 |
| Product Page |
www.avivasysbio.com/znf2-antibody-n-terminal-region-arp35997-t100.html |
| Name |
ZNF2 Antibody - N-terminal region (ARP35997_T100) |
| Protein Size (# AA) |
292 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
7549 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 2 |
| Alias Symbols |
A1-5, ZNF661, Zfp661 |
| Peptide Sequence |
Synthetic peptide located within the following region: KFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Rocchi,M., et al., (1999) Cytogenet. Cell Genet. 86 (3-4), 305-306 |
| Description of Target |
The ZNF2 gene is part of a sub-family of structurally related finger protein genes. Members of this sub-family are expressed as multiple transcripts in several cell lines. |
| Protein Interactions |
KRTAP10-7; TSGA10; PRMT5; TRIM28; APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF2 (ARP35997_T100) antibody |
| Blocking Peptide |
For anti-ZNF2 (ARP35997_T100) antibody is Catalog # AAP35997 (Previous Catalog # AAPP07307) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF2 |
| Uniprot ID |
Q9BSG1 |
| Protein Name |
Zinc finger protein 2 |
| Protein Accession # |
NP_066574 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021088 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
