ZNF529 Antibody - N-terminal region (ARP35986_P050)

• Product Number: ARP35986_P050
• Name: ZNF529 Antibody - N-terminal region (ARP35986_P050)
• Protein Size (# AA): 458 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 57711
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 529
• Alias Symbols: KIAA1615
• Peptide Sequence: Synthetic peptide located within the following region: QMKIISENVPSYKTHESLTLPRRTHDSEKPYEYKEYEKVFSCDLEFDEYQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
• Description of Target: The function of the Anti-ZNF529 gene has not yet been determined
• Protein Interactions: UBC; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF529 (ARP35986_P050) antibody is Catalog # AAP35986 (Previous Catalog # AAPP07244)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF529
• Uniprot ID: Q9H731
• Protein Name: Zinc finger protein 529
• Sample Type Confirmation:

  ZNF529 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_066002
• Purification: Affinity Purified
• Nucleotide Accession #: NM_020951
• Tested Species Reactivity: Human
• Gene Symbol: ZNF529
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 77%; Horse: 90%; Human: 100%; Mouse: 91%; Pig: 85%; Rabbit: 79%; Rat: 90%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF529 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysateZNF529 is supported by BioGPS gene expression data to be expressed in Jurkat