ZBTB26 Antibody - middle region (ARP35985_P050)

Data Sheet
 
Product Number ARP35985_P050
Product Page www.avivasysbio.com/zbtb26-antibody-middle-region-arp35985-p050.html
Name ZBTB26 Antibody - middle region (ARP35985_P050)
Protein Size (# AA) 441 amino acids
Molecular Weight 50kDa
NCBI Gene Id 57684
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger and BTB domain containing 26
Alias Symbols ZNF481, bioref
Peptide Sequence Synthetic peptide located within the following region: QIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRVS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target ZBTB26 contains 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Protein Interactions SUMO1P1; ZBTB26; PBK; GIPC2; ZBTB6; SUMO1; UBE2I; CYP2W1; EIF6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZBTB26 (ARP35985_P050) antibody
Blocking Peptide For anti-ZBTB26 (ARP35985_P050) antibody is Catalog # AAP35985 (Previous Catalog # AAPP07243)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZBTB26
Uniprot ID Q9HCK0
Protein Name Zinc finger and BTB domain-containing protein 26
Protein Accession # NP_065975
Purification Affinity Purified
Nucleotide Accession # NM_020924
Tested Species Reactivity Human
Gene Symbol ZBTB26
Predicted Species Reactivity Human, Mouse, Rat, Cow, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZBTB26 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com