Product Number |
ARP35985_P050 |
Product Page |
www.avivasysbio.com/zbtb26-antibody-middle-region-arp35985-p050.html |
Name |
ZBTB26 Antibody - middle region (ARP35985_P050) |
Protein Size (# AA) |
441 amino acids |
Molecular Weight |
50kDa |
NCBI Gene Id |
57684 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger and BTB domain containing 26 |
Alias Symbols |
ZNF481, bioref |
Peptide Sequence |
Synthetic peptide located within the following region: QIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRVS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
ZBTB26 contains 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation. |
Protein Interactions |
SUMO1P1; ZBTB26; PBK; GIPC2; ZBTB6; SUMO1; UBE2I; CYP2W1; EIF6; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZBTB26 (ARP35985_P050) antibody |
Blocking Peptide |
For anti-ZBTB26 (ARP35985_P050) antibody is Catalog # AAP35985 (Previous Catalog # AAPP07243) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZBTB26 |
Uniprot ID |
Q9HCK0 |
Protein Name |
Zinc finger and BTB domain-containing protein 26 |
Protein Accession # |
NP_065975 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020924 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZBTB26 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZBTB26 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|
|