ZNF471 Antibody - N-terminal region (ARP35981_P050)

• Product Number: ARP35981_P050
• Name: ZNF471 Antibody - N-terminal region (ARP35981_P050)
• Protein Size (# AA): 626 amino acids
• Molecular Weight: 73kDa
• NCBI Gene Id: 57573
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 471
• Alias Symbols: ERP1, Z1971, Zfp78
• Peptide Sequence: Synthetic peptide located within the following region: KEIITHKETITKETEFKYTKFGKCIHLENIEESIYNHTSDKKSFSKNSMV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Description of Target: ZNF471 belongs to the krueppel C2H2-type zinc-finger protein family. Itcontains 15 C2H2-type zinc fingers and 1 KRAB domain. ZNF471 may be involved in transcriptional regulation.
• Protein Interactions: GOLGA8F; GOLGA8EP; HAUS1; COG7; CARD14; ZNF471; BANP; MIS18A; PHF20L1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF471 (ARP35981_P050) antibody is Catalog # AAP35981 (Previous Catalog # AAPP07239)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF471
• Uniprot ID: Q9BX82
• Protein Name: Zinc finger protein 471
• Protein Accession #: NP_065864
• Purification: Affinity Purified
• Nucleotide Accession #: NM_020813
• Tested Species Reactivity: Human
• Gene Symbol: ZNF471
• Predicted Species Reactivity: Human, Mouse, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Horse: 77%; Human: 100%; Mouse: 77%; Pig: 77%
• Image 1: Human HepG2
  
  WB Suggested Anti-ZNF471 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysate