Product Number |
ARP35973_P050 |
Product Page |
www.avivasysbio.com/znf286-antibody-n-terminal-region-arp35973-p050.html |
Name |
ZNF286 Antibody - N-terminal region (ARP35973_P050) |
Protein Size (# AA) |
521 amino acids |
Molecular Weight |
60kDa |
NCBI Gene Id |
57335 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 286A |
Alias Symbols |
ZNF286 |
Peptide Sequence |
Synthetic peptide located within the following region: GALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
Located on chromosome 17, the ZNF286 encodes zinc finger protein 286 with unknown function. |
Protein Interactions |
KRTAP10-5; KRTAP10-1; KRT40; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF286A (ARP35973_P050) antibody |
Blocking Peptide |
For anti-ZNF286A (ARP35973_P050) antibody is Catalog # AAP35973 (Previous Catalog # AAPP07231) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF286 |
Uniprot ID |
Q9HBT8 |
Protein Name |
Zinc finger protein 286A |
Protein Accession # |
NP_065703 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020652 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF286A |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF286 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|