ZNF307 Antibody - N-terminal region (ARP35963_T100)

Data Sheet
 
Product Number ARP35963_T100
Product Page www.avivasysbio.com/znf307-antibody-n-terminal-region-arp35963-t100.html
Name ZNF307 Antibody - N-terminal region (ARP35963_T100)
Protein Size (# AA) 545 amino acids
Molecular Weight 62kDa
NCBI Gene Id 387032
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger with KRAB and SCAN domains 4
Alias Symbols ZNF307, ZNF427, ZSCAN36, P1P373C6
Peptide Sequence Synthetic peptide located within the following region: MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota T, (2004) Nat Genet. 36(1):40-5
Description of Target ZNF307 contains 1 SCAN box domain, 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the Krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Protein Interactions ZKSCAN4; ZNF496; LXN; TRIM39; CABP5; ZKSCAN7; ZSCAN32; SCAND1; TERF2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZKSCAN4 (ARP35963_T100) antibody
Blocking Peptide For anti-ZKSCAN4 (ARP35963_T100) antibody is Catalog # AAP35963 (Previous Catalog # AAPP07221)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF307
Uniprot ID Q969J2
Protein Name Zinc finger protein with KRAB and SCAN domains 4
Protein Accession # NP_061983
Purification Protein A purified
Nucleotide Accession # NM_019110
Tested Species Reactivity Human
Gene Symbol ZKSCAN4
Predicted Species Reactivity Human, Cow, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Horse: 100%; Human: 100%; Rabbit: 85%
Image 1
Transfected 293T
WB Suggested Anti-ZNF307 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com