ZNF167 Antibody - N-terminal region (ARP35958_T100)

• Product Number: ARP35958_T100
• Name: ZNF167 Antibody - N-terminal region (ARP35958_T100)
• Protein Size (# AA): 754 amino acids
• Molecular Weight: 85kDa
• NCBI Gene Id: 55888
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 167
• Alias Symbols: ZFP, ZNF64, ZNF167, ZNF448, ZSCAN39
• Peptide Sequence: Synthetic peptide located within the following region: LGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Calabro,V., et al., (1995) Hum. Genet. 95 (1), 18-21
• Description of Target: ZNF167, a gene located on chromosome 3, encodes for a zinc finger protein.
• Protein Interactions: ZKSCAN4; ZNF446; SCAND1; ZSCAN12; ZSCAN21; TCEANC; CBX2; CBX6; CBX4; UBC; ZSCAN32; NFIC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZKSCAN7 (ARP35958_T100) antibody is Catalog # AAP35958 (Previous Catalog # AAPP07216)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF167
• Uniprot ID: Q9P0L1
• Protein Name: Zinc finger protein 167
• Protein Accession #: NP_061121
• Purification: Protein A purified
• Nucleotide Accession #: NM_018651
• Tested Species Reactivity: Human
• Gene Symbol: ZKSCAN7
• Predicted Species Reactivity: Human, Rat
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rat: 79%
• Image 1: Human Intestine
  
  Human Intestine
• Image 2: Human Jurkat
  
  WB Suggested Anti-ZNF167 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate