ZNF446 Antibody - N-terminal region (ARP35944_T100)

Data Sheet
 
Product Number ARP35944_T100
Product Page www.avivasysbio.com/znf446-antibody-n-terminal-region-arp35944-t100.html
Name ZNF446 Antibody - N-terminal region (ARP35944_T100)
Protein Size (# AA) 450 amino acids
Molecular Weight 49kDa
NCBI Gene Id 55663
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 446
Alias Symbols ZSCAN30, ZSCAN52, ZKSCAN20
Peptide Sequence Synthetic peptide located within the following region: GSVQLSCSVKEEPNVDGQEVAPSSPPLAAQSPEGNHGHQEPASTSFHPPR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Liu,F., et al., (2005) Biochem. Biophys. Res. Commun. 333 (1), 38850
Description of Target ZNF446 is a new candidate transcription factor
Protein Interactions NOTCH2NL; KRTAP10-3; ZSCAN22; ZNF396; KRT40; ZNF496; PGBD1; LZTS2; ZNF397; ZSCAN16; ZKSCAN7; ZNF446; ZSCAN32; ZNF232; ZSCAN9; ZNF165; ZSCAN21; ZNF24; TRIM27; PIN1; DGCR6; ACTN2; FHL5; DGCR6L; SUFU; ZNF263;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF446 (ARP35944_T100) antibody
Blocking Peptide For anti-ZNF446 (ARP35944_T100) antibody is Catalog # AAP35944 (Previous Catalog # AAPP07202)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF446
Uniprot ID Q9NWS9
Protein Name Zinc finger protein 446
Protein Accession # NP_060378
Purification Protein A purified
Nucleotide Accession # NM_017908
Tested Species Reactivity Human
Gene Symbol ZNF446
Predicted Species Reactivity Human, Rat, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 79%; Guinea Pig: 86%; Human: 100%; Rat: 86%
Image 1
Human Jurkat
WB Suggested Anti-ZNF446 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com