| Product Number |
ARP35941_T100 |
| Product Page |
www.avivasysbio.com/znf416-antibody-n-terminal-region-arp35941-t100.html |
| Name |
ZNF416 Antibody - N-terminal region (ARP35941_T100) |
| Protein Size (# AA) |
594 amino acids |
| Molecular Weight |
67kDa |
| NCBI Gene Id |
55659 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 416 |
| Peptide Sequence |
Synthetic peptide located within the following region: QVRTPEASPSTQKIQSCDMCVPFLTDILHLTDLPGQELYLTGACAVFHQD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZNF416 may be involved in transcriptional regulation |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF416 (ARP35941_T100) antibody |
| Blocking Peptide |
For anti-ZNF416 (ARP35941_T100) antibody is Catalog # AAP35941 (Previous Catalog # AAPP08233) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF416 |
| Uniprot ID |
Q9BWM5 |
| Protein Name |
Zinc finger protein 416 |
| Protein Accession # |
NP_060349 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_017879 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF416 |
| Predicted Species Reactivity |
Human, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rabbit: 79% |
| Image 1 | Human 293T
 | WB Suggested Anti-ZNF416 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate |
|
|
