Product Number |
ARP35913_T100 |
Product Page |
www.avivasysbio.com/vgll1-antibody-n-terminal-region-arp35913-t100.html |
Name |
VGLL1 Antibody - N-terminal region (ARP35913_T100) |
Protein Size (# AA) |
258 amino acids |
Molecular Weight |
29kDa |
NCBI Gene Id |
51442 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Vestigial like 1 (Drosophila) |
Alias Symbols |
TDU, VGL1 |
Peptide Sequence |
Synthetic peptide located within the following region: LFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Vaudin,P., et al., (1999) Development 126 (21), 4807-4816 |
Description of Target |
VGLL1 is a specific coactivator for the mammalian TEFs. The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed. |
Protein Interactions |
TEAD3; TEAD4; TEAD1; TEAD2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-VGLL1 (ARP35913_T100) antibody |
Blocking Peptide |
For anti-VGLL1 (ARP35913_T100) antibody is Catalog # AAP35913 (Previous Catalog # AAPP08215) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human VGLL1 |
Uniprot ID |
Q99990 |
Protein Name |
Transcription cofactor vestigial-like protein 1 |
Protein Accession # |
NP_057351 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_016267 |
Tested Species Reactivity |
Human |
Gene Symbol |
VGLL1 |
Predicted Species Reactivity |
Human, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rat: 86% |
Image 1 | Human Jurkat
| WB Suggested Anti-VGLL1 Antibody Titration: 2.5ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
|
|