TRIP4 Antibody - middle region (ARP35908_T100)

Data Sheet
 
Product Number ARP35908_T100
Product Page www.avivasysbio.com/trip4-antibody-middle-region-arp35908-t100.html
Name TRIP4 Antibody - middle region (ARP35908_T100)
Protein Size (# AA) 581 amino acids
Molecular Weight 66kDa
NCBI Gene Id 9325
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Thyroid hormone receptor interactor 4
Alias Symbols ASC1, ASC-1, MDCDC, SMABF1, ZC2HC5, HsT17391
Peptide Sequence Synthetic peptide located within the following region: VCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Jung,D.J., et al., (2002) Mol. Cell. Biol. 22 (14), 5203-5211
Description of Target TRIP4 is a transcription coactivator of nuclear receptors which functions in conjunction with CBP-p300 and SRC-1 and may play an important role in establishing distinct coactivator complexes under different cellular conditions. TRIP4 plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. TRIP4 acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. It plays a role in androgen receptor transactivation and in testicular function
Protein Interactions FUS; NEK6; RELA; UBC; MED11; MED8; MED10; MED25; MED28; MED15; MED4; RCOR1; MED13; MED12; MED24; MED27; MED17; MED23; MED1; POLR2A; PPARG; ESR2; XBP1; NR2F2; PAX9; ASCC2; ASCC3; THRB; RARA; TRIP4; EP300; NCOA1; GTF2A1; CREBBP; TBP; AR; RXRA; JUN; NFKB1; E
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TRIP4 (ARP35908_T100) antibody
Blocking Peptide For anti-TRIP4 (ARP35908_T100) antibody is Catalog # AAP35908 (Previous Catalog # AAPP07162)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TRIP4
Uniprot ID Q15650
Protein Name Activating signal cointegrator 1
Protein Accession # NP_057297
Purification Protein A purified
Nucleotide Accession # NM_016213
Tested Species Reactivity Human
Gene Symbol TRIP4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human 293T
WB Suggested Anti-TRIP4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com