| Product Number |
ARP35903_P050 |
| Product Page |
www.avivasysbio.com/etv7-antibody-c-terminal-region-arp35903-p050.html |
| Name |
ETV7 Antibody - C-terminal region (ARP35903_P050) |
| Protein Size (# AA) |
341 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
51513 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ets variant 7 |
| Alias Symbols |
TEL2, TELB, TEL-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: IIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEIS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cardone,M., (2005) Mol. Cell. Biol. 25 (6), 2395-2405 |
| Description of Target |
As a transcriptional repressor; ETV7 binds to the DNA sequence 5'-CCGGAAGT-3'. But Isoform A and isoform C do not seem to have a repressor activity. |
| Protein Interactions |
VTN; LRPAP1; UBC; IRF4; L3MBTL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ETV7 (ARP35903_P050) antibody |
| Blocking Peptide |
For anti-ETV7 (ARP35903_P050) antibody is Catalog # AAP35903 (Previous Catalog # AAPP08905) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ETV7 |
| Uniprot ID |
Q9Y603 |
| Protein Name |
Transcription factor ETV7 |
| Protein Accession # |
NP_057219 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016135 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ETV7 |
| Predicted Species Reactivity |
Human, Dog, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 82%; Horse: 79%; Human: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-ETV7 Antibody Titration: 0.0625ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T |
|
|
