ZNF232 Antibody - middle region (ARP35881_P050)

• Product Number: ARP35881_P050
• Name: ZNF232 Antibody - middle region (ARP35881_P050)
• Protein Size (# AA): 444 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 7775
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 232
• Alias Symbols: ZSCAN11
• Peptide Sequence: Synthetic peptide located within the following region: PFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mavrogiannis,L.A., et al., (2001) Biochim. Biophys. Acta 1518 (3), 300-305
• Description of Target: ZNF232 is a new candidate transcription factor.
• Protein Interactions: PPCDC; ZNF446; MTUS2; EMD; ALB; NR2E3; YY1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF232 (ARP35881_P050) antibody is Catalog # AAP35881 (Previous Catalog # AAPP08202)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF232
• Uniprot ID: Q9UNY5
• Protein Name: Zinc finger protein 232
• Sample Type Confirmation:

  ZNF232 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_055334
• Purification: Affinity Purified
• Nucleotide Accession #: NM_014519
• Tested Species Reactivity: Human
• Gene Symbol: ZNF232
• Predicted Species Reactivity: Human, Rat, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 86%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF232 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysateZNF232 is supported by BioGPS gene expression data to be expressed in Jurkat