| Product Number |
ARP35874_P050 |
| Product Page |
www.avivasysbio.com/btbd15-antibody-c-terminal-region-arp35874-p050.html |
| Name |
BTBD15 Antibody - C-terminal region (ARP35874_P050) |
| Protein Size (# AA) |
467 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
29068 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger and BTB domain containing 44 |
| Alias Symbols |
BTBD15, ZNF851, HSPC063 |
| Peptide Sequence |
Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function. |
| Protein Interactions |
PSMA6; FAM124A; SMYD1; ZBTB44; WDFY3; POLI; GLRX3; AP1M1; RAD23A; SMURF2; SMAD7; SMAD1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZBTB44 (ARP35874_P050) antibody |
| Blocking Peptide |
For anti-ZBTB44 (ARP35874_P050) antibody is Catalog # AAP35874 (Previous Catalog # AAPP07128) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD15 |
| Uniprot ID |
Q86XX5 |
| Protein Name |
Zinc finger and BTB domain-containing protein 44 |
| Publications |
Cooper, C. D. O. et al. Identification and characterization of peripheral T-cell lymphoma-associated SEREX antigens. PLoS One 6, e23916 (2011). 21887344 |
| Protein Accession # |
NP_054874 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014155 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZBTB44 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-BTBD15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
