BTBD15 antibody - C-terminal region (ARP35874_P050)
Data Sheet
 
Product Number ARP35874_P050
Product Page www.avivasysbio.com/btbd15-antibody-c-terminal-region-arp35874-p050.html
Product Name BTBD15 antibody - C-terminal region (ARP35874_P050)
Size 100 ul
Gene Symbol ZBTB44
Alias Symbols BTBD15, ZNF851, HSPC063
Protein Size (# AA) 467 amino acids
Molecular Weight 52kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 29068
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger and BTB domain containing 44
Description This is a rabbit polyclonal antibody against BTBD15. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV
Target Reference Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function.
Protein Interactions PSMA6; FAM124A; SMYD1; ZBTB44; WDFY3; POLI; GLRX3; AP1M1; RAD23A; SMURF2; SMAD7; SMAD1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZBTB44 (ARP35874_P050) antibody is Catalog # AAP35874 (Previous Catalog # AAPP07128)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD15
Complete computational species homology data Anti-BTBD15 (ARP35874_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BTBD15.
Swissprot Id Q86XX5
Protein Name Zinc finger and BTB domain-containing protein 44
Publications

Cooper, C. D. O. et al. Identification and characterization of peripheral T-cell lymphoma-associated SEREX antigens. PLoS One 6, e23916 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21887344

Protein Accession # NP_054874
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BTBD15.
Nucleotide Accession # NM_014155
Replacement Item This antibody may replace item sc-102166 from Santa Cruz Biotechnology.
Conjugation Options

ARP35874_P050-FITC Conjugated

ARP35874_P050-HRP Conjugated

ARP35874_P050-Biotin Conjugated

CB Replacement sc-102166; sc-117376; sc-155450; sc-96802
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Image 1
Human HepG2
WB Suggested Anti-BTBD15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com