Product Number |
ARP35872_T100 |
Product Page |
www.avivasysbio.com/znf224-antibody-n-terminal-region-arp35872-t100.html |
Name |
ZNF224 Antibody - N-terminal region (ARP35872_T100) |
Protein Size (# AA) |
707 amino acids |
Molecular Weight |
82kDa |
NCBI Gene Id |
7767 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 224 |
Alias Symbols |
BMZF2, KOX22, ZNF27, BMZF-2, ZNF233, ZNF255 |
Peptide Sequence |
Synthetic peptide located within the following region: FSKEGDFPCQTEAGLSVIHTRQKSSQGNGYKPSFSDVSHFDFHQQLHSGE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Shannon,M., et al., (2003) Genome Res. 13 (6A), 1097-1110 |
Description of Target |
Matrix-assisted laser desorption ionization-time of flight analysis and examination of protein profiles from the SwissProt database revealed that the previously defined p97 repressor is ZNF224, a zinc finger protein. ZNF224, a Kruppel-like zinc finger transcription factor, is the repressor protein that specifically binds to the negative cis-element AldA-NRE and affects the AldA-NRE-mediated transcription. |
Protein Interactions |
MTUS2; SUMO1; SUMO3; TRIM28; PRMT5; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF224 (ARP35872_T100) antibody |
Blocking Peptide |
For anti-ZNF224 (ARP35872_T100) antibody is Catalog # AAP35872 (Previous Catalog # AAPP08024) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF224 |
Uniprot ID |
Q9NZL3 |
Protein Name |
Zinc finger protein 224 |
Sample Type Confirmation |
There is BioGPS gene expression data showing that ZNF224 is expressed in Jurkat |
Protein Accession # |
NP_037530 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_013398 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF224 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF224 Antibody Titration: 2.5ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that ZNF224 is expressed in Jurkat |
|
|