ZNF224 Antibody - N-terminal region (ARP35872_T100)

Data Sheet
 
Product Number ARP35872_T100
Product Page www.avivasysbio.com/znf224-antibody-n-terminal-region-arp35872-t100.html
Name ZNF224 Antibody - N-terminal region (ARP35872_T100)
Protein Size (# AA) 707 amino acids
Molecular Weight 82kDa
NCBI Gene Id 7767
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 224
Alias Symbols BMZF2, KOX22, ZNF27, BMZF-2, ZNF233, ZNF255
Peptide Sequence Synthetic peptide located within the following region: FSKEGDFPCQTEAGLSVIHTRQKSSQGNGYKPSFSDVSHFDFHQQLHSGE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Shannon,M., et al., (2003) Genome Res. 13 (6A), 1097-1110
Description of Target Matrix-assisted laser desorption ionization-time of flight analysis and examination of protein profiles from the SwissProt database revealed that the previously defined p97 repressor is ZNF224, a zinc finger protein. ZNF224, a Kruppel-like zinc finger transcription factor, is the repressor protein that specifically binds to the negative cis-element AldA-NRE and affects the AldA-NRE-mediated transcription.
Protein Interactions MTUS2; SUMO1; SUMO3; TRIM28; PRMT5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF224 (ARP35872_T100) antibody
Blocking Peptide For anti-ZNF224 (ARP35872_T100) antibody is Catalog # AAP35872 (Previous Catalog # AAPP08024)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF224
Uniprot ID Q9NZL3
Protein Name Zinc finger protein 224
Sample Type Confirmation

There is BioGPS gene expression data showing that ZNF224 is expressed in Jurkat

Protein Accession # NP_037530
Purification Protein A purified
Nucleotide Accession # NM_013398
Tested Species Reactivity Human
Gene Symbol ZNF224
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZNF224 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that ZNF224 is expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com